Protein coding transcript 132162

• Transcript: Ll_transcript_95172
• CDS coordinates: 2-484 (+)
• Peptide sequence: QEKVEKQRQMPFHMHINLELLECVYMVSAMLIEIPYMAEHEFDARRRMISKTFYQQLRSSERQSLLGPPESMREHVVAASKAMRNGNWKACNKYIINEKMNAKVWDLFYQADEVRTMLTKLIREEALRTYLFTYSHVYDSISMATLAETFELEPSVVHSII
• ORF Type: internal

Annotations of Ll_transcript_95172

• Blastp: Eukaryotic translation initiation factor 3 subunit C from Stegomyia with 81.37% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit C from Stegomyia with 81.37% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XRU3)
• Kegg: Link to kegg annotations (AaeL_AAEL000175)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003530952.1)
• Pfam: Eukaryotic translation initiation factor 3 subunit 8 N-terminus (PF05470.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;