Protein coding transcript 132164

• Transcript: Ll_transcript_95182
• CDS coordinates: 199-846 (+)
• Peptide sequence: MSSLSDDCREHLLEIDDNGHINGGGGGDHLTKSKFQIRNLTKDSDAGVSILKGITVDIPKGVVVGIIGPSGSGKSTLLRALNRLWEPPSSTVFLDGEDITDLDVLSLRRKVGMLFQLPALFEGTVADNVRYGPQLRGKKLSDDEVRKLLIMADLDDSFLGKSGTELSVGQAQRVALARTLANSPEVNIAATSCSQLMHKNETIGNAFLASLWIVF*
• ORF Type: complete

Annotations of Ll_transcript_95182

• Blastp: ABC transporter I family member 17 from Arabidopsis with 67.42% of identity
• Blastx: ABC transporter I family member 17 from Arabidopsis with 73.72% of identity
• Eggnog: Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the transport system (By similarity)(COG1117)
• Kegg: Link to kegg annotations (AT1G67940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446124.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;