Protein coding transcript 132166

• Transcript: Ll_transcript_95249
• CDS coordinates: 1-345 (+)
• Peptide sequence: QMSHRKTCYAKHTQVRAIRKKMVEIITRDVASSDLKEVVNKLLPDSIAKDIEKACQGIYPLHDVYIRKVKVLKKPRFELSKLLELHGDGGKASDEPGAKVERPEGYEPPVQESV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_95249

• Blastp: 40S ribosomal protein S3a from Periplaneta with 92.11% of identity
• Blastx: 40S ribosomal protein S3a from Periplaneta with 92.11% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015941545.1)
• Pfam: Ribosomal S3Ae family (PF01015.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;