Transcript | Ll_transcript_95256 |
---|---|
CDS coordinates | 31-489 (+) |
Peptide sequence | MIRSICKLPTTLAGQMAVNILSRSMAGQAPQKMEDYFKGKKFIVTGSCAGMGEKITERLVDLGSFVYAVVEKEEGAAKALPNTKQIFCDVSNWEDTYKKMYDIGPVHGLVNNAGVAVIEPFFDVTEHGWDKTLNINARALVRISQAVAKKHD* |
ORF Type | complete |
Blastp | L-xylulose reductase from Homo with 33.33% of identity |
---|---|
Blastx | L-xylulose reductase from Homo with 50.81% of identity |
Eggnog | )-reductase(ENOG410XQCY) |
Kegg | Link to kegg annotations (51181) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004503163.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer