Protein coding transcript 132170

• Transcript: Ll_transcript_95183
• CDS coordinates: 2-562 (+)
• Peptide sequence: LPSFLTRDLHLNPFHQFQPHHQDNNNNTDEDNNNSTHNNNDNFLNRSLNRGPNENTTPNNTASASAATADGKELSSTMSPGDGEMGTIRRSRGRPAGSKNKPQQPIIINKDSANALRSHVIEISDGCDVMEGVTAYARRRQRGVCILSGSGAVTNVTLKQPASAGAVVTLHGRFEILSLSGSFLPPP
• ORF Type: internal

Annotations of Ll_transcript_95183

• Blastp: AT-hook motif nuclear-localized protein 21 from Arabidopsis with 67.33% of identity
• Blastx: AT-hook motif nuclear-localized protein 21 from Arabidopsis with 68% of identity
• Eggnog: DNA-binding protein ESCAROLA-like(ENOG410YG7Z)
• Kegg: Link to kegg annotations (AT2G35270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450020.1)
• Pfam: Domain of unknown function (DUF296) (PF03479.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;