Protein coding transcript 132171

• Transcript: Ll_transcript_95161
• CDS coordinates: 52-528 (+)
• Peptide sequence: MSSVNMSTMTLRAPVPYLSGRTFCALVKTPSSSSSSYFGSKKNVPKVFGLKSSSFRVCATGEVYKVKVIGPDGEENEFDAPDDTYILDAADNAGLDLPSLCRAGTCSNCVAQLVSGSVDQSDQLCLDEQQVQKGYVLACVAYPKSDCVIHTHKESELM*
• ORF Type: complete

Annotations of Ll_transcript_95161

• Blastp: Ferredoxin-3, chloroplastic from Arabidopsis with 52.83% of identity
• Blastx: Ferredoxin-3, chloroplastic from Arabidopsis with 52.83% of identity
• Eggnog: Ferredoxin(COG0633)
• Kegg: Link to kegg annotations (AT2G27510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451954.1)
• Pfam: 2Fe-2S iron-sulfur cluster binding domain (PF00111.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;