Transcript | Ll_transcript_95203 |
---|---|
CDS coordinates | 1-627 (+) |
Peptide sequence | KIIGQVRLGLQCLQLRNLPSMLYICVGPLSSFIFQNLNKIQITGCSKLRVLFPTSVLRYLPELEVLEIQDCNELKQIIEKDTDLKNNLLSPKPCFPKLEVLVVKDCYNLKCLIHESSDVPKVKTIRIERCAMLQVMFTASNNLRYLPELKNLEIKQCWGLEKITEEDHINFLQPCFPKLEVLVIKECYSLKNLINASNDAPNIQKIRIE |
ORF Type | internal |
Blastp | Internalin-I from Listeria with 30.26% of identity |
---|---|
Blastx | Internalin-I from Listeria with 30.26% of identity |
Eggnog | Histidine triad protein(ENOG4111RAF) |
Kegg | Link to kegg annotations (lmo0333) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460168.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer