Protein coding transcript 132175

• Transcript: Ll_transcript_95197
• CDS coordinates: 3-368 (+)
• Peptide sequence: LQLFRGDTVLLKGKRRKETVCIVLADETVPDEKIRMNRVVRNNLRVRLSDVVSVQPCPDVKYGKRIHVLPIDDTVEGLTGNLFEVYLKPYFLEAYRPIHKDDAFIVRGGMRAVEFKVVETDP
• ORF Type: internal

Annotations of Ll_transcript_95197

• Blastp: Transitional endoplasmic reticulum ATPase from Danio with 87.7% of identity
• Blastx: Transitional endoplasmic reticulum ATPase from Danio with 87.7% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (327197)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003554388.1)
• Pfam: Cell division protein 48 (CDC48), N-terminal domain (PF02359.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;