Protein coding transcript 132177

• Transcript: Ll_transcript_95266
• CDS coordinates: 50-454 (-)
• Peptide sequence: KATTVKKDKEGHYIMIKGLVENITILNIYAPDTGAPKFIKQLLLDLRNEIDSNTIIVGDFNTPLTALDRSSRQKVNKETMDLYYTLQQMDLTDICRTFYPTTAEYTFFSSAHGTFSRMDHILGQKASLNKFFKV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_95266

• Blastp: LINE-1 retrotransposable element ORF2 protein from Homo with 62.12% of identity
• Blastx: LINE-1 retrotransposable element ORF2 protein from Homo with 58.55% of identity
• Eggnog: NA(ENOG410Y9TZ)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017411387.1)
• Pfam: Endonuclease-reverse transcriptase (PF14529.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;