Protein coding transcript 132180

• Transcript: Ll_transcript_95254
• CDS coordinates: 2-496 (+)
• Peptide sequence: ETSRGAYRVSSYVLANTLVFIPFLLMVAFLYTTPVYWLVGLRKDIDGFLYFSLVVWLVLFMSNSLVACFSALVPNFILGTSVIAGLMGSFFLFSGYFISKEKIPSYWIFMHYLSLFKYPFECLMINEYGGKQGKTRCIVNSNGQCLLHGVELLRQQGLKESHKWT
• ORF Type: internal

Annotations of Ll_transcript_95254

• Blastp: ABC transporter G family member 10 from Arabidopsis with 69.09% of identity
• Blastx: ABC transporter G family member 10 from Arabidopsis with 69.09% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT1G53270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443884.1)
• Pfam: ABC-2 type transporter (PF01061.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;