Protein coding transcript 132182

• Transcript: Ll_transcript_95226
• CDS coordinates: 3-653 (-)
• Peptide sequence: GEGIAFVIAPSESLPPNSYGQYLGLTNAATDGNRTNNLVAVELDTVKQDFDPDDNHIGLNINSVRSNVSVSLSKLGIQISPNGTVFHVIWVDYDGERKVIDVYIADQDDKDAPIVAKPKKPVLSSSLDLKSLVNQESYFGFSASTGITYQLNCVLRWNISITVFPENKSNKDWNAITIGLCVGVPLVLIGIGVLVYLLVKKKKASSSDPQIMGTLKS
• ORF Type: internal

Annotations of Ll_transcript_95226

• Blastp: Probable L-type lectin-domain containing receptor kinase S.5 from Arabidopsis with 36.07% of identity
• Blastx: L-type lectin-domain containing receptor kinase IV.1 from Arabidopsis with 33.89% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G06740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445140.1)
• Pfam: Legume lectin domain (PF00139.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;