Protein coding transcript 132183

• Transcript: Ll_transcript_95214
• CDS coordinates: 3-365 (+)
• Peptide sequence: EQYAQQDQVKKDRVEALNQADSIVNDTESKLTEYQVHIPEEDASNIRELIKEVREKIAQAQASEQDPEELKASTQKLQQASLKMFEVAYKKMAAKREQENSGNQNQSGDGQTTEQETTKKE
• ORF Type: internal

Annotations of Ll_transcript_95214

• Blastp: Stress-70 protein, mitochondrial from Bos with 40.5% of identity
• Blastx: Stress-70 protein, mitochondrial from Homo with 41.82% of identity
• Eggnog: Heat shock protein(COG0443)
• Kegg: Link to kegg annotations (517535)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419398.1)
• Pfam: Hsp70 protein (PF00012.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;