Protein coding transcript 132188

• Transcript: Ll_transcript_165074
• CDS coordinates: 137-1213 (+)
• Peptide sequence: MLWVDKYRPKTLDHVMVHDLIAQNLKKLVTEQDCPHLLFYGPSGSGKKTLIMALLRQMFGPGAEKVKVENRTWKVDAGSRSIDIELTTLQSANHTEISPSDAGFQDRYVVQEIIKDMAKNRPIDTKGKKGGFKVLVLNDVDKLSREAQHSLRRTMEKYSAYCRLILCCNSSSRVTEAIRSRCLNVRINAPSEEQIADVLEFIGKKEGLQLPSGFAARIAEKSNRNLRRAILSFETCRVQQYPFTSKQAIPPMDWEEYISEIASDIMKEQSPKRLFQVRGKLYELLINCIPPEIILKRLVYELLRKLDDELKHEVCHWASYYEHRMRLGQKAIFHIEGIFDPNVLVVKLTFIYVISFEC*
• ORF Type: complete

Annotations of Ll_transcript_165074

• Blastp: Replication factor C subunit 3 from Arabidopsis with 80.11% of identity
• Blastx: Replication factor C subunit 3 from Arabidopsis with 80.11% of identity
• Eggnog: DNA polymerase III subunit delta'(COG0470)
• Kegg: Link to kegg annotations (AT5G27740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428561.1)
• Pfam: Rad17 cell cycle checkpoint protein (PF03215.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;