Protein coding transcript 132190

• Transcript: Ll_transcript_165161
• CDS coordinates: 49-423 (+)
• Peptide sequence: MEVKREKEIQAQLDASKPKNDIKSTTVVKKVVAEWNEENIQLLVKAVNLFPAGTNQRWEVVSNFINQHGKFSADSSKFNAKLVLAKAKDLQNTDFTKNNLKETANKQAFENFKKDKKNVLHIDES
• ORF Type: 3prime_partial

Annotations of Ll_transcript_165161

• Blastp: DnaJ homolog subfamily C member 2 from Danio with 43.8% of identity
• Blastx: DnaJ homolog subfamily C member 2 from Danio with 43.8% of identity
• Eggnog: Transcription factor(COG5269)
• Kegg: Link to kegg annotations (403080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020220777.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;