Protein coding transcript 132194

• Transcript: Ll_transcript_165103
• CDS coordinates: 1-543 (+)
• Peptide sequence: TKFCYYNNYSLSQPRFFCKACKRYWTQGGILRNIPVGGAPRKRKRSKGSSSSSSTTLNSSSGQQSQPQLQPQPQPQPATREVVQQLQNQPNMTTLMRPIPPRVVQSTNPYYQGGGVGGGYLSSLAAVHSLNPLPQPLNQSLNVGVGDVVASTNLGLLSGFNAHASLGLQHQYPGQIHAPRF
• ORF Type: internal

Annotations of Ll_transcript_165103

• Blastp: Dof zinc finger protein DOF3.2 from Arabidopsis with 75% of identity
• Blastx: Dof zinc finger protein DOF3.2 from Arabidopsis with 87.18% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G45610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446641.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;