Protein coding transcript 132197

• Transcript: Ll_transcript_165172
• CDS coordinates: 1-588 (+)
• Peptide sequence: WKCAMPVRVMKLIGVDYLIATNAAGGLNPTYNIGDIMLVKDHINLMGFAGNNPLQGPNDDRFGIRFPPMNQAYDRQLMKDALQVAKDMGISDIVHEGVYTCLGGPNFETVAELKMLKMLGVDAVGMSTVHEVITARHCQMTVFTFSLITNCCVTDYDTYELPNHEEVMDVGKMRQGILKDFVKTVVLNISKKYVK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_165172

• Blastp: Purine nucleoside phosphorylase from Bos with 56.08% of identity
• Blastx: Purine nucleoside phosphorylase from Bos with 57.38% of identity
• Eggnog: The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate (By similarity)(COG0005)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013466483.1)
• Pfam: Phosphorylase superfamily (PF01048.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;