Protein coding transcript 132198

• Transcript: Ll_transcript_165069
• CDS coordinates: 1-330 (+)
• Peptide sequence: MKRGDWYKTKEILLKGTDWILNEMKTSGLRGRGGAGFPTGMKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGRAMGAKAAYIYIRGEFYNEA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_165069

• Blastp: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial from Mus with 93.64% of identity
• Blastx: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial from Mus with 93.64% of identity
• Eggnog: Nadh dehydrogenase(COG1894)
• Kegg: Link to kegg annotations (17995)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015940680.1)
• Pfam: Respiratory-chain NADH dehydrogenase 51 Kd subunit (PF01512.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;