Protein coding transcript 132205

• Transcript: Ll_transcript_165102
• CDS coordinates: 218-898 (+)
• Peptide sequence: MENGDGQGEAMDDDFDLNMDFSKTKKKKKKKKDIDELVAEEMDKKGDKFDDTTDGESHTWFGSDRDYTYDELLTRVFEIMREKNPDMVAGKKQKFVMRPPQVVRIGTKKTSFANFTEICKTLHRQPKHLLDFLLAELGTSGSVDGNSQLIIKGRFQQKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQCETCGSRCSVASIKSGFQAVTGKRAAIRAKTA*
• ORF Type: complete

Annotations of Ll_transcript_165102

• Blastp: Eukaryotic translation initiation factor 2 subunit 2 from Sophophora with 79.62% of identity
• Blastx: Eukaryotic translation initiation factor 2 subunit 2 from Sophophora with 71.08% of identity
• Eggnog: translation Initiation Factor(COG1601)
• Kegg: Link to kegg annotations (Dmel_CG4153)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418085.1)
• Pfam: Domain found in IF2B/IF5 (PF01873.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;