Transcript | Ll_transcript_165169 |
---|---|
CDS coordinates | 3-752 (+) |
Peptide sequence | RLLPTMVLHAPTATAAALVLFVGLALGQQQNNRGEFQCPQKPGFYADQIQCDLYYHCSVDGELTEKLCPDGLLFDDSSPSHEKCDTSVNVDCGQRTVQQEPKPSKGCPRANGYYRHWDEGVCDKFVNCVDGNANEMPCPPGLVYDDSTSSCAWATDSKRQCTTTKRDALTDGFTCPDGDVVGPNGRILPHPTFAHPDDCQKFYICRNGVIPQYGSCSAGTVYNDVSFKCDDPENVPGCENYYENEDEKKG |
ORF Type | internal |
Blastp | Protein obstructor-E from Sophophora with 30.74% of identity |
---|---|
Blastx | Protein obstructor-E from Sophophora with 30.4% of identity |
Eggnog | cuticular protein analogous to peritrophins 3-E(ENOG4111HJZ) |
Kegg | Link to kegg annotations (Dmel_CG11142) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003588948.2) |
Pfam | Chitin binding Peritrophin-A domain (PF01607.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer