Protein coding transcript 132219

• Transcript: Ll_transcript_165061
• CDS coordinates: 3-425 (+)
• Peptide sequence: EYRIMLNKVTIGLNETQLGIVAPTWFTATMKNTIGFRQTELALTQGKLFTTNDAMKIGLVDELADSKEDALAKAETFLSKFARIPPMARILTKQSVRGKDIQDLIQNQERDLNVFMDSITNDQVQKSLQMYVEALKKKKA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_165061

• Blastp: Enoyl-CoA delta isomerase 1, mitochondrial from Mus with 44.37% of identity
• Blastx: Enoyl-CoA delta isomerase 1, mitochondrial from Mus with 44.37% of identity
• Eggnog: Enoyl-CoA hydratase(COG1024)
• Kegg: Link to kegg annotations (13177)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014517832.1)
• Pfam: Enoyl-CoA hydratase/isomerase (PF00378.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;