Protein coding transcript 132220

• Transcript: Ll_transcript_250821
• CDS coordinates: 3-311 (+)
• Peptide sequence: LDSPEDAEFIVAKAIRDGVVEATLDPEKGYMRSKESADIYCTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDD
• ORF Type: internal

Annotations of Ll_transcript_250821

• Blastp: Probable 26S proteasome non-ATPase regulatory subunit 3 from Anopheles with 97.09% of identity
• Blastx: Probable 26S proteasome non-ATPase regulatory subunit 3 from Anopheles with 97.09% of identity
• Eggnog: 26S proteasome nonATPase regulatory subunit(ENOG410XS40)
• Kegg: Link to kegg annotations (AgaP_AGAP009082)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004500920.1)
• Pfam: Proteasome regulatory subunit C-terminal (PF08375.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;