Transcript | Ll_transcript_250897 |
---|---|
CDS coordinates | 63-425 (+) |
Peptide sequence | MAPKYKLHYFNVTALGEPVRFLLAYGKADWDDVRYEVEEWEKVKSSMPFGQMPVLEIDGKQFAQSVALARYLAKQYGLTGKNDLENLQIDIAVDLFNDFRTKIGGWFYDPLPESKASKEGP |
ORF Type | 3prime_partial |
Blastp | Glutathione S-transferase from Blattella with 57.02% of identity |
---|---|
Blastx | Glutathione S-transferase from Blattella with 57.02% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013458730.1) |
Pfam | Glutathione S-transferase, N-terminal domain (PF02798.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer