Protein coding transcript 132225

• Transcript: Ll_transcript_250863
• CDS coordinates: 101-751 (+)
• Peptide sequence: MAVIDFQTAPGVEFLENHLSKRSYIVGYEPSTADVDTYAAVKAPQANTPNLLRWYNHIKSFTDKERTQFPKKKSEFSSAPASAPKPADDDDDVDLFGSDDEDDEEKERIKQERVKAYAEKKATKKVIIAKSSIVLDVKPWDDETDMKQLETQVRTIAMDGLVWGASKLVEIAFGIKKLQIMCVVEDDKVSVDALTETIQEFEDFVQSVDIAAFNKI*
• ORF Type: complete

Annotations of Ll_transcript_250863

• Blastp: Elongation factor 1-beta from Artemia with 59.45% of identity
• Blastx: Elongation factor 1-beta' from Bombyx with 60.81% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020206151.1)
• Pfam: Eukaryotic elongation factor 1 beta central acidic region (PF10587.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;