Transcript | Ll_transcript_250819 |
---|---|
CDS coordinates | 2-370 (+) |
Peptide sequence | FNSLLHLHPFLSLFFGDDSRIPRWYQSLRLVGRLLYLTISRPDICYVVQQLSLFMANPMDSHLKAATRVLQYLKNSPAQGLFFSATSPLKFPAFSDSDWACCLDSRKSITGFCIFMGPTLIS* |
ORF Type | 5prime_partial |
Blastp | Uncharacterized mitochondrial protein AtMg00240 from Arabidopsis with 50.63% of identity |
---|---|
Blastx | Uncharacterized mitochondrial protein AtMg00240 from Arabidopsis with 50.63% of identity |
Eggnog | Retrotransposon protein(COG2801) |
Kegg | Link to kegg annotations (ArthMp021) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447344.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer