Transcript | Ll_transcript_250834 |
---|---|
CDS coordinates | 3-812 (+) |
Peptide sequence | LNTIKMKYFVFCALFALTYANVDVNQLKKLQALPEFAGVSLVELEAQTRLTVPDLIESEGYPSETYEVTTEDGYILTLHRIPLGKNAKKSNGKVAFLQHGILSSSCDWIITGSSKALAYILADEGYDVWMGNARGNRYSRNHTTLNPDKDSEFWKFSWHQIGAVDLPTMIDFVLEKTGVPSVYYAGHSQGTTSFFVMTSFKPEYNEKIKVQVSLAPIGFMNHMTSPFFRILAFWGKPLGLLLDLIGVDEFLPNNAFMDSFGSVICGDHSI |
ORF Type | internal |
Blastp | Lipase 3 from Sophophora with 51.4% of identity |
---|---|
Blastx | Lipase 3 from Sophophora with 51.4% of identity |
Eggnog | Alpha beta hydrolase(COG0596) |
Kegg | Link to kegg annotations (Dmel_CG8823) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020211098.1) |
Pfam | Partial alpha/beta-hydrolase lipase region (PF04083.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer