Protein coding transcript 132257

• Transcript: Ll_transcript_250852
• CDS coordinates: 2-454 (+)
• Peptide sequence: SSSTMSTNKKKTRKLRGHVSHGHGRVGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKLGMRNYHVRKNSKHCPTLNLDRLWSLVTEQTRLNAQKTEKAPVIDVVRAGYYKVLGKGHLPKQPVIVRAKFFSRSAEEKIKAAGGACVLTA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_250852

• Blastp: 60S ribosomal protein L27a from Bos with 78.38% of identity
• Blastx: 60S ribosomal protein L27a from Bos with 77.48% of identity
• Eggnog: Binds to the 23S rRNA (By similarity)(COG0200)
• Kegg: Link to kegg annotations (404190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017420786.1)
• Pfam: Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A (PF00828.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;