Protein coding transcript 132270

• Transcript: Ll_transcript_77840
• CDS coordinates: 8-505 (+)
• Peptide sequence: MTHTLSCHKTRPLSFFKRKEPSPIKILPQQKTMRPPSKKIDFIQGDKVEVCSKEPGFLGSYYEANIVSRLDNGLYVVCYKNLLEDDESKPLTETVYPKELRPFPPKIHATHFFLYQKVDAFDNDGWWVGEITGKNGSYYFVYFASTNEEIAYHCSNIRVHQEWVNG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_77840

• Blastp: DUF724 domain-containing protein 6 from Arabidopsis with 33.07% of identity
• Blastx: DUF724 domain-containing protein 3 from Arabidopsis with 32.54% of identity
• Eggnog: Protein of unknown function (DUF724)(ENOG410YXA1)
• Kegg: Link to kegg annotations (AT2G47230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465330.1)
• Pfam: Agenet domain (PF05641.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;