Protein coding transcript 132275

• Transcript: Ll_transcript_77841
• CDS coordinates: 3-743 (+)
• Peptide sequence: HSIAPQLDHYACMVDLYGRAGKIVEAEELIHKMPMKPDSVIWSSLLGSCRKHGETRLAKLAADKFNELEPEKSLGYVQMSNIYSSGGSFIEAGLIRKEMRESKVRKEPGLSWVEIGKQVHEFGSGGKHHPQRGAIVQQLEILTGRLKEIGYAPEVSLALYDTEEEHKEDQLFHHSEKMALVFAIMNEGKLSSGGNVIKIMKNIRICVDCHNFMKLASYLCKKEIIVRDSNRFHHFNYATCSCNDYW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_77841

• Blastp: Pentatricopeptide repeat-containing protein At1g71420 from Arabidopsis with 61.38% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g71420 from Arabidopsis with 61.38% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G71420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420445.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;