Protein coding transcript 132280

• Transcript: Ll_transcript_77832
• CDS coordinates: 3-428 (+)
• Peptide sequence: ENGQRHFIRFCYLLSWHQPNTKMRIIRALLSSAARAPKEFSAYDKFMYRADGYCKYGLLKDDLLSEHSDEVVEALRRLPEETIMQRIYRQNRAANLSMTHSILPESQWTKIEEDLPYLAPYVEEVEAEIAEKKNWEENNPL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_77832

• Blastp: Cytochrome b-c1 complex subunit 7 from Mus with 45.71% of identity
• Blastx: Cytochrome b-c1 complex subunit 7 from Mus with 47.25% of identity
• Eggnog: component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain (By similarity)(ENOG4111V1G)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004498653.1)
• Pfam: Ubiquinol-cytochrome C reductase complex 14kD subunit (PF02271.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;