Protein coding transcript 132283

• Transcript: Ll_transcript_77804
• CDS coordinates: 1-621 (-)
• Peptide sequence: MKIKTFKDDDIKISIWNLAGQHEFFSLHDLMFPGRGSASFFVIISSLFRKSSNRELKSMTEVEEDLQYWLRFIVSNSKRAIQQCMVPSVAVVLTHFDKISQPSQNLQLTIDSIQRLRDKFQGFVDFYPTVFTVDARSSASVSKLTHHIRKTCKTILQRVPRVYQLCNDLIQILSDWRSENYNKPAMKWKEFCELCQVKVPPLRIQSR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_77804

• Blastp: Protein TORNADO 1 from Arabidopsis with 71.98% of identity
• Blastx: Protein TORNADO 1 from Arabidopsis with 69.88% of identity
• Eggnog: NA(ENOG4111F3H)
• Kegg: Link to kegg annotations (AT5G55540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447100.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;