Transcript | Ll_transcript_77881 |
---|---|
CDS coordinates | 195-650 (+) |
Peptide sequence | MLLLCVISCIALVLDPLIIVERKLCVEAMGISSQPSLVSISLTNLLEGSEEHRKSSSYEYLWNKVLEGGKVRKKSVQYKRPRRTLMKRRVGSRRGVKGIQRKVRTLKRLVPNSESLELDGLFRETTDYILALQTRVRIMQVMVNVLKGSDE* |
ORF Type | complete |
Blastp | Transcription factor UPBEAT1 from Arabidopsis with 51.39% of identity |
---|---|
Blastx | Transcription factor UPBEAT1 from Arabidopsis with 58.49% of identity |
Eggnog | Transcription factor(ENOG4111CN7) |
Kegg | Link to kegg annotations (AT2G47270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427947.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer