Protein coding transcript 132296

• Transcript: Ll_transcript_77812
• CDS coordinates: 68-556 (+)
• Peptide sequence: MDHMLALRYVQGTLKYGLHLYPSPIEKLVSYTDANWGGCPNSRRSTSSYCVFLGDNLISWSSKRQPTLSRSSAEAEYRGVANVVSEFCWLHNLLLELHFPLTQATLMYCDNVSAIYLSANSVQHQRIKHIEMDIHFVREKVTHGHTRILHVPSHHQITYIFTK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_77812

• Blastp: Copia protein from Sophophora with 35.4% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 50.43% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002209)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435861.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;