Protein coding transcript 132297

• Transcript: Ll_transcript_77853
• CDS coordinates: 2-1060 (+)
• Peptide sequence: KAGNVVHLYERDCSVQRRHQKVVEMAPAPHLDPKVRNQMTDLAVKLAKHVGYENAGTVEFLCDSKGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRIAEGMTLPELGISQDKIVPQGFAIQCRVTTEDPAKNFQPDTGRIEVFRSGEGMGIRLDGASAFAGAIISPYYDSLLVKVIAHSKDLQSACAKMNRALREFRVRGVKTNVPFLLNVLENQKFINGAVDTYFIEENPQLFNFQPTKNRAQKLLNYLAQVLVNGPQTPLATKLKPAEIKPHVPIASTEYLAYTPEQNPSAQPPRGLRQVYKEQGPEAFAKAVRNNKGLLLMDTTYRDAHQSLLATRVRSHDLLKISPF
• ORF Type: internal

Annotations of Ll_transcript_77853

• Blastp: Pyruvate carboxylase 1 from Caenorhabditis with 67.24% of identity
• Blastx: Pyruvate carboxylase 1 from Caenorhabditis with 67.24% of identity
• Eggnog: Catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second (By similarity)(COG1038)
• Kegg: Link to kegg annotations (CELE_D2023.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003630608.2)
• Pfam: Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;