Protein coding transcript 132304

• Transcript: Ll_transcript_69961
• CDS coordinates: 2-745 (+)
• Peptide sequence: DFSIIQILSLFTTSHKLNYLKIIYIKLMGILYALVARGTVVLAEFSVTSSNANTIAKQILDKIPGTNDTHVSYSQDRYIFHVKRTDGLTVLCMADDNAGRRVPFAFLEEIHQRFVRTYGRAVLSAQPYGMNDEFSRVLNQQIEYFSNDPNADRIHRLKGEMSQVRNVMIENIDKVLDRGDRLELLVDKTANMQGNTFRFRKQARRFRSTVWWRNVKLTIALIVILLVIVYVVLAFVCHGPALPSCLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69961

• Blastp: Vesicle-associated membrane protein 713 from Arabidopsis with 77.38% of identity
• Blastx: Vesicle-associated membrane protein 712 from Arabidopsis with 80.37% of identity
• Eggnog: Vesicle-associated membrane protein(COG5143)
• Kegg: Link to kegg annotations (AT5G11150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434739.1)
• Pfam: Regulated-SNARE-like domain (PF13774.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;