Protein coding transcript 132308

• Transcript: Ll_transcript_69946
• CDS coordinates: 1-525 (+)
• Peptide sequence: LLNLLLLYALVIITQLNLFLHHFIFKTTKKGPKQRRRRRVTTTSNNSSNKQKGTKASMANKSSFVFLVICATLLMAKTGVAGGEGMGFGWLPTTAAKPPCRGSITECMEEWEEFELDSEINRRMLATSSYISYDALRRNSVPCSRQGASYYNCRTGAEANPYSRGCSAITRCRS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69946

• Blastp: Protein RALF-like 1 from Arabidopsis with 55.26% of identity
• Blastx: Protein RALF-like 1 from Arabidopsis with 55.26% of identity
• Eggnog: Rapid ALkalinization Factor (RALF)(ENOG4111BVJ)
• Kegg: Link to kegg annotations (AT1G02900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441167.1)
• Pfam: Rapid ALkalinization Factor (RALF) (PF05498.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;