Protein coding transcript 132311

• Transcript: Ll_transcript_69988
• CDS coordinates: 3-713 (+)
• Peptide sequence: YRLCDMNPGEVTNKLVFFVNGKKIEDVHIDPEWTLLYYLRDKLRLCGTKLGCGEGGCGACTVMVSKYDRAKRQEVHLPVNACLAPVMSMHGLAVTTIEGIGSTKTKLHPVQERIAKAHGSQCGFCTPGIVMSMYTLLRNLPKPTMKDMEVAFQGNLCRCTGYRPIIEGYKTFTDEWELQQQSHNMNGNGVLNGKEITNGEKLSNDTGTVNVCGMGEKCCKLQNGESKEDEKALFKTS
• ORF Type: internal

Annotations of Ll_transcript_69988

• Blastp: Xanthine dehydrogenase from Sophophora with 63.68% of identity
• Blastx: Xanthine dehydrogenase from Sophophora with 63.43% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020224750.1)
• Pfam: 2Fe-2S iron-sulfur cluster binding domain (PF00111.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;