Protein coding transcript 132313

• Transcript: Ll_transcript_70026
• CDS coordinates: 2-619 (+)
• Peptide sequence: TNVKQEYGTSLCSSINEMQHLEKLYIDAIPFDEVIDLQSISPLPLLQKLRLRGKLQRMPKWIPRLKNLVRLSLISSMLIIDPLESLADMQNLLYLSLDSAYEGESLVFPKRGFKTLKKLSLRHMSSVNSIKVGKGALPSLKELMLDHIPELNYVPYGIENLGMLGIFHIINMAEEFRENIREDQWIKGHVGQVYIIDKVVGMGKD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_70026

• Blastp: Disease resistance protein RPM1 from Arabidopsis with 33.52% of identity
• Blastx: Disease resistance protein RPM1 from Arabidopsis with 33.52% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G07040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435244.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;