Protein coding transcript 132317

• Transcript: Ll_transcript_69973
• CDS coordinates: 62-613 (+)
• Peptide sequence: MYHAQDNYGQYAYGYATPTSTKSETKTADGVTQGGYSYIDSNGILQSVHYVADPVHGFRVAATNLPQDLPEVAWAKAKHLAEYNAISAEHASARVAYSNPVAVPIHEVRVLPQPVQDLPEVARARAEHLAVLNAAYAAQAVGANIPQVVQDLPEVQKARLEHLATVESIKQRDAVIRAQTASLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_69973

• Blastp: Cuticle protein 6 from Blaberus with 36.11% of identity
• Blastx: Cuticle protein 6 from Blaberus with 36.72% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014523810.1)
• Pfam: Insect cuticle protein (PF00379.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;