Protein coding transcript 132330

• Transcript: Ll_transcript_70009
• CDS coordinates: 39-692 (+)
• Peptide sequence: MKLLILFLFLLSTPLILVTTQDTDDFANQSDPNLLGLRKEEKLSHLKLYWHDIVSGKNPTSIVVVPPPPSNMNLTTAFGMVDIIDNPLTLGPELSSKLVGRAQGLYASTSQSEVNLLMAMNFVITDGKYSGSSITILGRNPTFNKVREMSVIGGSGYFRFARGYAELRTHYFSPKTMNAIVEYNIYVLHYSCSDALHKKLLNLILITLVPYILFLPF*
• ORF Type: complete

Annotations of Ll_transcript_70009

• Blastp: Dirigent protein 19 from Arabidopsis with 63.16% of identity
• Blastx: Dirigent protein 19 from Arabidopsis with 63.16% of identity
• Eggnog: Disease resistance response protein(ENOG410YGJA)
• Kegg: Link to kegg annotations (AT1G58170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460349.1)
• Pfam: Dirigent-like protein (PF03018.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;