Protein coding transcript 132332

• Transcript: Ll_transcript_69920
• CDS coordinates: 3-431 (+)
• Peptide sequence: GHGRGGGVVEVDKVDEGVDVEDENEAASWLLLNPVKNNSSNNNNEQSNGFMFDEYLEQLDCNSCGDNYRQQNQHQQQEQNFQIGLDFDQSHRFSYNGSIGQNVSVSSIDIGIVPESSMRDVSISHPSPTEGTIDLFYGPPCHL
• ORF Type: internal

Annotations of Ll_transcript_69920

• Blastp: Zinc finger protein CONSTANS-LIKE 2 from Arabidopsis with 37.58% of identity
• Blastx: Zinc finger protein CONSTANS-LIKE 2 from Arabidopsis with 35.14% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT3G02380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454988.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;