Protein coding transcript 132336

• Transcript: Ll_transcript_69924
• CDS coordinates: 2-1222 (+)
• Peptide sequence: SNSGNGNLNLKASSEINKNDVVSVSVNSAFPATSFEDEKTRCEENRASEFECSPGLKNDVVSDLACTEKLQFSYYDDESEYGSTQETSSFCDLHSEIFVGSSELELSDYSPSLFIDSGSQFTQGSGEETETPSPTYSLFLQYRKEFSTLTSQISNASSVEDEVTLKYKYERFEDLDDEESYKMLRKRERKQVLMSNYAETYISTTEVGELVLQQRSQMVRWITEQSYRKQLRPETLFLGVSLLDRFLSKGYFKTKRSLQLVGIACLTLATRIEENQQNNRVGQKNFYIGCSVYSRIEVVAMEWMVQEVLKFQCFLPTIHNFLWFYLKAAKADAVMEKRVKNLSVLALSAHEHVCYWPSTVAAALVILACLEFNQEASSKVIAIHVRSKDENLHECMESLEWLLRFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69924

• Blastp: Cyclin-SDS from Arabidopsis with 49.71% of identity
• Blastx: Cyclin-SDS from Arabidopsis with 49.71% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (AT1G14750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459745.1)
• Pfam: Cyclin, N-terminal domain (PF00134.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;