| Transcript | Ll_transcript_70021 |
|---|---|
| CDS coordinates | 130-477 (+) |
| Peptide sequence | MAAGKKQKKALESINTKLALVMKSGKCVLGLKQSLKTLRQGKSKLVIIANNTSPLRVSEIEYYAMLSKTDVFQYSGNNIELGTACGKYFRVATLSITDPGDSDIIKTIPTDQANQ* |
| ORF Type | complete |
| Blastp | 60S ribosomal protein L30 from Spodoptera with 75.89% of identity |
|---|---|
| Blastx | 60S ribosomal protein L30 from Spodoptera with 75.89% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_004516683.1) |
| Pfam | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer