| Transcript | Ll_transcript_69949 |
|---|---|
| CDS coordinates | 3-467 (+) |
| Peptide sequence | QRAMREQVLLAIQQVQSVNLRHKVCEVVAEVARNLIDDDGNNQWPEFLQFLFHCANDQNPVLKEAALQMFTSVPGVFGNQQNNYLDLIKQMLMQSLQPTESYEVRFQAVRAVGAFILINDKETQILKHYADLLAPMLQVIGESVQQQEDDTLLKV |
| ORF Type | internal |
| Blastp | Importin-5 from Homo with 49.35% of identity |
|---|---|
| Blastx | Importin-5 from Homo with 49.35% of identity |
| Eggnog | Importin(ENOG410XQAJ) |
| Kegg | Link to kegg annotations (3843) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017438613.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer