Transcript | Ll_transcript_69949 |
---|---|
CDS coordinates | 3-467 (+) |
Peptide sequence | QRAMREQVLLAIQQVQSVNLRHKVCEVVAEVARNLIDDDGNNQWPEFLQFLFHCANDQNPVLKEAALQMFTSVPGVFGNQQNNYLDLIKQMLMQSLQPTESYEVRFQAVRAVGAFILINDKETQILKHYADLLAPMLQVIGESVQQQEDDTLLKV |
ORF Type | internal |
Blastp | Importin-5 from Homo with 49.35% of identity |
---|---|
Blastx | Importin-5 from Homo with 49.35% of identity |
Eggnog | Importin(ENOG410XQAJ) |
Kegg | Link to kegg annotations (3843) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017438613.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer