Protein coding transcript 132345

• Transcript: Ll_transcript_69985
• CDS coordinates: 161-937 (+)
• Peptide sequence: MAKSLLIVSALFLAVVASVTAAPTPKKQIAFNLCKKSDPNLDRCLKTSIQSVIPDLAEGYPKLRIPAIEPFELPSLEIEHGKGSSKAVSIDLKLKDVKIMGLTSAVVDALKVDVDNFKTSGKISFTKPLEITGQYTVNGKVLVLPITGNGPCSIVLNEPVLELEEMSGTPFEKNGKTFVQIKKVNLKVASVKNLNVKLENLFNGNKQLGDSMNSILNQNWEVLLEELKPAFEEAIGAISQDIVNKVFQKTAYSDIFLL*
• ORF Type: complete

Annotations of Ll_transcript_69985

• Blastp: Circadian clock-controlled protein from Sophophora with 29.55% of identity
• Blastx: Protein takeout from Sophophora with 31.53% of identity
• Eggnog: circadian rhythm(ENOG4110N42)
• Kegg: Link to kegg annotations (Dmel_CG2650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_012569928.1)
• Pfam: Haemolymph juvenile hormone binding protein (JHBP) (PF06585.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;