Protein coding transcript 132346

• Transcript: Ll_transcript_69922
• CDS coordinates: 2-334 (+)
• Peptide sequence: NVCVVYSHKRQKQTTMMKKLSIVCRIVLVFTLLVELSFKVDAVNCNPVNLGPCLQAVTTNVTPSNTCCQRLREQIPCLCGYIQNPLLSGYLKFPGAKKVSSSCRVPFPTC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69922

• Blastp: Probable non-specific lipid-transfer protein AKCS9 from Vigna with 48.1% of identity
• Blastx: Probable non-specific lipid-transfer protein AKCS9 from Vigna with 48.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003624386.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;