Protein coding transcript 132349

• Transcript: Ll_transcript_69963
• CDS coordinates: 64-438 (+)
• Peptide sequence: MASVQSVQCFGKKKTATAVAHCKQGKGLIKVNGQPLSLVEPQVLRFKVYEPVLLLGLDKFAGIDIRVRVRGGGHTSQVYAIRQAIAKGIVSYYQKYVDEHSKNQLKQALIQYDRTLLVADNRRCE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_69963

• Blastp: 40S ribosomal protein S16-B from Saccharomyces with 76% of identity
• Blastx: 40S ribosomal protein S16-B from Saccharomyces with 76% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YDL083C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433639.1)
• Pfam: Ribosomal protein S9/S16 (PF00380.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;