Protein coding transcript 132350

• Transcript: Ll_transcript_69927
• CDS coordinates: 3-923 (+)
• Peptide sequence: QFPNLNDVVIKNAHIGRVDANAFGENVKNVNFMGCAFEDSPNLFSKNLEELNIKNSKLNDIPVLKLPNLLFLNLTENNIKKVNVEAFARLQGIEQIDLSFNKIEELPADIFINNQELEIVYLDNNPLRHFSLNTSNNIEFLSARACQLPKFDQSSTKFLDGLSELYLNDNQIDAIRGIDLAHMPELLIIDLSNNKIDRLLPDVFENNTKLQKITLDGNKLKYLPIFVSAYDKTFDTYKFSCKNCGLVKTIAYQTFERLTGLKELILSGNELTSVAESFTKLPSLRILDLSNNKLRNIERTAFAKNMR
• ORF Type: internal

Annotations of Ll_transcript_69927

• Blastp: Toll-like receptor 7 from Sophophora with 29.04% of identity
• Blastx: Toll-like receptor 7 from Sophophora with 28.69% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (Dmel_CG8595)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452091.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;