Protein coding transcript 132353

• Transcript: Ll_transcript_96850
• CDS coordinates: 2-370 (+)
• Peptide sequence: WNLVDDDLLKYKYLNNWDAAMNHAEQKYGWLHSAPGYVSWKHESDKVIAFERGNCLFVFNFHPTQSFPDYTLGIEFGGEFRIVLCSDDEQFGGHKRVDTSIPIFTKPEEYACRRNRLQVYIPS
• ORF Type: internal

Annotations of Ll_transcript_96850

• Blastp: 1,4-alpha-glucan-branching enzyme from Rhizophagus with 56.56% of identity
• Blastx: 1,4-alpha-glucan-branching enzyme from Rhizophagus with 56.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003554420.1)
• Pfam: Alpha amylase, C-terminal all-beta domain (PF02806.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;