Protein coding transcript 132354

• Transcript: Ll_transcript_96907
• CDS coordinates: 1-396 (+)
• Peptide sequence: KPAVPKAEKPAAKPAVPKAEKEEKPADASAVKKAVAKASKPKADSKKVPGGVKKPRAKKMVLKGKNAKVKKLALKFYLDCTNPVEDNILDVVNFEKYLQERIKVNGKLNNFGKNITVERQKNKLCLHSSVPF
• ORF Type: internal

Annotations of Ll_transcript_96907

• Blastp: 60S ribosomal protein L22 from Sophophora with 57.33% of identity
• Blastx: 60S ribosomal protein L22 from Sophophora with 57.33% of identity
• Eggnog: Ribosomal protein(ENOG4111UVJ)
• Kegg: Link to kegg annotations (Dmel_CG7434)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016205560.1)
• Pfam: Ribosomal L22e protein family (PF01776.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;