Protein coding transcript 132355

• Transcript: Ll_transcript_96925
• CDS coordinates: 3-476 (-)
• Peptide sequence: MSELLGVRILQQHLPIRAEEIKLFLKSPMKKSELKEKVNVGEEVAMLSNNIITRTALRRRCYDVEGEGHQLIELVKEMSELGGKFNLGDMWFVKKFDLQGFGKRLESVRSKFDAIMERIMKEHEDARKKREEEEEMGRKGDQSVKDLLDILLDIYADE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_96925

• Blastp: Cytochrome P450 93A2 from Soja with 43.4% of identity
• Blastx: Cytochrome P450 93A3 from Soja with 49.07% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (100797067)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443063.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;